PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000693146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 246aa    MW: 27294.5 Da    PI: 10.5279
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000693146genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP837.7e-26160225268
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtsss 68 
                    +g kdrhsk++ ++g+RdR v l a++a++f+d+q +L +d++sk ++WL+++ak+ai+el++  ++
  MDP0000693146 160 TGWKDRHSKVCKAKGLRDRCVWLAAHTAIQFYDVQYRLDYDRPSKVVDWLIKKAKAAIDELPSW-NP 225
                    677**********************************************************987.22 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.9E-23161230IPR005333Transcription factor, TCP
PROSITE profilePS5136925.646162220IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MYTGGAFXAD SELKKIDELL LLDLALHKCQ KVKSSXKXPL GEDRRNPSRE RQGCTKLFVF  60
PARPTNPAPA FLWRNPTVAA VRTSANLAAS SKETQFHFFN FGGKEHRICK IKNEGFSPSP  120
VHHQATTSSR MGIRSPSSSG GVVNTDIVEV VQGSHIVRAT GWKDRHSKVC KAKGLRDRCV  180
WLAAHTAIQF YDVQYRLDYD RPSKVVDWLI KKAKAAIDEL PSWNPHSTST TTAAIVVRPK  240
PVLFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5310211e-100AB531021.1 Malus x domestica MdTCP4A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391670.11e-145PREDICTED: transcription factor TCP4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2494423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.38e-35TCP family protein